PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_26.316
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family MIKC_MADS
Protein Properties Length: 211aa    MW: 24739.3 Da    PI: 9.6267
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_26.316genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.57.1e-28959151
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  krien snrqvt+skRrngi+KKA+E+ vLCda+v++iif+s+gk++ey+s
  evm.model.supercontig_26.316  9 KRIENLSNRQVTYSKRRNGIIKKAKEITVLCDARVSLIIFASSGKMHEYCS 59
                                  79***********************************************96 PP

2K-box79.39.2e-2772167297
                         K-box   2 qkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqk 82 
                                   +k+ + +l++ak+e+l++e++++kke++n+q e+Rhl Ged++sL++++L+ Le+ Le++l ++R+k++e+l+++ ++ + 
  evm.model.supercontig_26.316  72 HKAGKPRLWDAKHENLNNEIERVKKENDNMQIELRHLRGEDITSLNHRDLMALEETLETGLASVRNKQMEVLKMMRRNEKI 152
                                   5555666************************************************************************99 PP

                         K-box  83 kekelqeenkaLrkk 97 
                                    e+e+++   aL+++
  evm.model.supercontig_26.316 153 LEEENRRLSFALQQQ 167
                                   999999999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.987161IPR002100Transcription factor, MADS-box
SMARTSM004324.2E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.66E-34296IPR002100Transcription factor, MADS-box
CDDcd002653.59E-38280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-28323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-211057IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-283859IPR002100Transcription factor, MADS-box
PfamPF014868.6E-1983163IPR002487Transcription factor, K-box
PROSITE profilePS5129715.17884170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MGRGKIEIKR IENLSNRQVT YSKRRNGIIK KAKEITVLCD ARVSLIIFAS SGKMHEYCSP  60
STSLTNMLDE YHKAGKPRLW DAKHENLNNE IERVKKENDN MQIELRHLRG EDITSLNHRD  120
LMALEETLET GLASVRNKQM EVLKMMRRNE KILEEENRRL SFALQQQEIA IENSAREMEN  180
GYQQRMREYN AHMPFAFRVQ PIQPNLQDRI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D1e-16277174MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-16277174MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-16277174MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A1e-16277174MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_S2e-16177175Myocyte-specific enhancer factor 2B
1tqe_R2e-16177175Myocyte-specific enhancer factor 2B
1tqe_Q2e-16177175Myocyte-specific enhancer factor 2B
1tqe_P2e-16177175Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF5625000.0EF562500.1 Carica papaya B-class MADS-box protein PI mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012078322.11e-120PREDICTED: floral homeotic protein PMADS 2
SwissprotQ074741e-104MADS2_PETHY; Floral homeotic protein PMADS 2
TrEMBLA5JSC71e-155A5JSC7_CARPA; B-class MADS-box protein PI
STRINGPOPTR_0005s20480.11e-113(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Representative plantOGRP53021222
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.15e-95MIKC_MADS family protein
Publications ? help Back to Top
  1. Ackerman CM, et al.
    B-class MADS-box genes in trioecious papaya: two paleoAP3 paralogs, CpTM6-1 and CpTM6-2, and a PI ortholog CpPI.
    Planta, 2008. 227(4): p. 741-53
    [PMID:17985156]